PDB entry 1avv

View 1avv on RCSB PDB site
Description: hiv-1 nef protein, unliganded core domain
Class: myristylation
Keywords: myristylation, GTP-binding, phosphorylation, hiv-1, nef, virus, pxxp motif
Deposited on 1997-09-21, released 1998-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: negative factor
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 NEF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1avva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avvA (A:)
    gsleaqeeeevgfpvtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiy
    htqgyfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmdd
    perevlewrfdsrlafhhvarelhpeyfknc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avvA (A:)
    vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
    rypltfgwcyklvpevlewrfdsrlafhhvarelhpeyf