PDB entry 1avu

View 1avu on RCSB PDB site
Description: trypsin inhibitor from soybean (sti)
Class: serine protease inhibitor
Keywords: serine protease inhibitor, trypsin inhibitor, kunitz-type, beta-trefoil fold
Deposited on 1997-09-20, released 1998-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avuA (A:)
    dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
    pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
    ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkldkes
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avuA (A:)
    dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
    pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
    ervsefnnyklvfcpqqdkcgdigisidhddgtrrlvvsknkplvvqfqkld