PDB entry 1avt

View 1avt on RCSB PDB site
Description: subtilisin carlsberg d-para-chlorophenyl-1-acetamido boronic acid inhibitor complex
Class: serine protease
Keywords: serine protease, hydrolase, boronic acid inhibitors
Deposited on 1997-09-19, released 1998-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin carlsberg, type viii
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00780 (0-273)
      • conflict (101)
      • conflict (127)
      • conflict (156)
      • conflict (159)
      • conflict (210)
      • modified residue (219)
    Domains in SCOPe 2.07: d1avta_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avtA (A:)
    aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
    nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
    inmslggasgstamkqavdnayargvvvvaaagnsgnsgstntigypakydsviavgavd
    snsnrasfssvgaelevmapgagvystyptntyatlngtamasphvagaaalilskhpnl
    sasqvrnrlsstatylgssfyygkglinveaaaq