PDB entry 1avq

View 1avq on RCSB PDB site
Description: toroidal structure of lambda exonuclease determined at 2.4 angstroms
Class: deoxyribonuclease
Keywords: deoxyribonuclease, DNA recombination and repair, 5'-3' exonuclease
Deposited on 1997-09-18, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda exonuclease
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avqa_
  • Chain 'B':
    Compound: lambda exonuclease
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avqb_
  • Chain 'C':
    Compound: lambda exonuclease
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avqc_
  • Heterogens: PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avqA (A:)
    shmtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyf
    htllaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacsp
    dglcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydpr
    mkreglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avqB (B:)
    shmtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyf
    htllaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacsp
    dglcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydpr
    mkreglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1avqC (C:)
    shmtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyf
    htllaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacsp
    dglcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydpr
    mkreglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avqC (C:)
    tpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyfhtl
    laevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacspdgl
    csdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydprmkr
    eglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr