PDB entry 1avp

View 1avp on RCSB PDB site
Description: structure of human adenovirus 2 proteinase with its 11 amino acid cofactor
Class: hydrolase
Keywords: thiol hydrolase, viral proteinase, peptide cofactor
Deposited on 1996-04-04, released 1997-11-19
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adenoviral proteinase
  Species: Human adenovirus 2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03252 (0-203)
  Domains in SCOP 1.75: d1avpa_
• Chain 'B':
  Compound: adenoviral proteinase
  Species: Human adenovirus 2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03274 (0-10)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1avpA (A:)
  mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
  nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
  acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
  hspyfrshsaqirsatsfchlknm
  

  
  
• Chain 'B':
  No sequence available.