PDB entry 1avp

View 1avp on RCSB PDB site
Description: structure of human adenovirus 2 proteinase with its 11 amino acid cofactor
Deposited on 1996-04-04, released 1997-11-19
The last revision prior to the SCOP 1.55 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1avpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avpA (A:)
    mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
    nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
    acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
    hspyfrshsaqirsatsfchlknm