PDB entry 1avp

View 1avp on RCSB PDB site
Description: structure of human adenovirus 2 proteinase with its 11 amino acid cofactor
Class: hydrolase
Keywords: thiol hydrolase, viral proteinase, peptide cofactor, hydrolase
Deposited on 1996-04-04, released 1997-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenoviral proteinase
    Species: Human adenovirus C [TaxId:10515]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1avpa_
  • Chain 'B':
    Compound: adenoviral proteinase
    Species: Human adenovirus C, synthetic [TaxId:10515]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avpA (A:)
    mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
    nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
    acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
    hspyfrshsaqirsatsfchlknm
    

  • Chain 'B':
    No sequence available.