PDB entry 1avm

View 1avm on RCSB PDB site
Description: the cambialistic superoxide dismutase (fe-sod) of p. shermanii coordinated by azide
Deposited on 1997-09-17, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.171
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avmA (A:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avmB (B:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva