PDB entry 1avm

View 1avm on RCSB PDB site
Description: the cambialistic superoxide dismutase (fe-sod) of p. shermanii coordinated by azide
Class: oxidoreductase
Keywords: oxidoreductase, sod, superoxide dismutase, propionibacterium shermanii, azide
Deposited on 1997-09-17, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avma1, d1avma2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avmb1, d1avmb2
  • Heterogens: FE, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avmA (A:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avmB (B:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva