PDB entry 1avh

View 1avh on RCSB PDB site
Description: crystal and molecular structure of human annexin v after refinement. implications for structure, membrane binding and ion channel formation of the annexin family of proteins
Class: calcium/phospholipid binding
Keywords: calcium/phospholipid binding
Deposited on 1991-10-17, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avha_
  • Chain 'B':
    Compound: annexin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avhb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avhA (A:)
    maqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktl
    fgrdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpe
    elraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalf
    qagelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllav
    vksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmi
    kgdtsgdykkallllcgedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avhA (A:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcgedd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1avhB (B:)
    maqvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktl
    fgrdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpe
    elraikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalf
    qagelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllav
    vksirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmi
    kgdtsgdykkallllcgedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avhB (B:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcgedd