PDB entry 1avg

View 1avg on RCSB PDB site
Description: thrombin inhibitor from triatoma pallidipennis
Class: complex (blood coagulation/inhibitor)
Keywords: bovine thrombin, thrombin inhibitor, complex (blood coagulation/inhibitor)
Deposited on 1997-09-16, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avg.1
  • Chain 'I':
    Compound: triabin
    Species: Triatoma pallidipennis [TaxId:30077]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27049 (0-141)
      • conflict (122)
      • conflict (126)
    Domains in SCOPe 2.07: d1avgi_
  • Chain 'L':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avg.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avgH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avgI (I:)
    aegddcsiekamgdfkpeeffngtwylahgpgvtspavcqkfttsgskgftqiveigynk
    fesnvkfqcnqvdnkngeqysfkckssdntefeadftfisvsydnfalvcrsitftsqpk
    edrylvfertksdtdpdakeic
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avgL (L:)
    ffnektfgageadcglrplfekkqvqdqtekelfesyiegr