PDB entry 1avf

View 1avf on RCSB PDB site
Description: activation intermediate 2 of human gastricsin from human stomach
Class: aspartyl protease
Keywords: aspartyl protease, gastricsin, aspartic proteinase, intermediate, activation, acid
Deposited on 1997-09-16, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.227
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gastricsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1avf.1
  • Chain 'J':
    Compound: gastricsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1avf.2
  • Chain 'P':
    Compound: gastricsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1avf.1
  • Chain 'Q':
    Compound: gastricsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1avf.2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avfA (A:)
    svtyepmaymdaayfgeisigtppqnflvlfdtgssnlwvpsvycqsqactshsrfnpse
    sstystngqtfslqygsgsltgffgydtltvqsiqvpnqefglsenepgtnfvyaqfdgi
    mglaypalsvdeattamqgmvqegaltspvfsvylsnqqgssggavvfggvdsslytgqi
    ywapvtqelywqigieefliggqasgwcsegcqaivdtgtslltvpqqymsallqatgaq
    edeygqflvncnsiqnlpsltfiingvefplppssyilsnngyctvgveptylssqngqp
    lwilgdvflrsyysvydlgnnrvgfataa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avfA (A:)
    vtyepmaymdaayfgeisigtppqnflvlfdtgssnlwvpsvycqsqactshsrfnpses
    stystngqtfslqysgsltgffgydtltvqsiqvpnqefglsenepgtnfvyaqfdgimg
    laypalsvdeattamqgmvqegaltspvfsvylsnggavvfggvdsslytgqiywapvtq
    elywqigieefliggqasgwcsegcqaivdtgtslltvpqqymsallqatgaqedeygqf
    lvncnsiqnlpsltfiingvefplppssyilsnngyctvgveptylssqngqplwilgdv
    flrsyysvydlgnnrvgfataa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1avfJ (J:)
    svtyepmaymdaayfgeisigtppqnflvlfdtgssnlwvpsvycqsqactshsrfnpse
    sstystngqtfslqygsgsltgffgydtltvqsiqvpnqefglsenepgtnfvyaqfdgi
    mglaypalsvdeattamqgmvqegaltspvfsvylsnqqgssggavvfggvdsslytgqi
    ywapvtqelywqigieefliggqasgwcsegcqaivdtgtslltvpqqymsallqatgaq
    edeygqflvncnsiqnlpsltfiingvefplppssyilsnngyctvgveptylssqngqp
    lwilgdvflrsyysvydlgnnrvgfataa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avfJ (J:)
    vtyepmaymdaayfgeisigtppqnflvlfdtgssnlwvpsvycqsqactshsrfnpses
    stystngqtfslqygsgsltgffgydtltvqsiqvpnqefglsenepgtnfvyaqfdgim
    glaypalsvdeattamqgmvqegaltspvfsvylsnggavvfggvdsslytgqiywapvt
    qelywqigieefliggqasgwcsegcqaivdtgtslltvpqqymsallqatgaqedeygq
    flvncnsiqnlpsltfiingvefplppssyilsnngyctvgveptylssqngqplwilgd
    vflrsyysvydlgnnrvgfataa
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1avfP (P:)
    avvkvplkkfksiretmkekgllgef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avfP (P:)
    avvkvplkkfksiretmkekg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1avfQ (Q:)
    avvkvplkkfksiretmkekgllgef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avfQ (Q:)
    avvkvplkkfksiretmkekgl