PDB entry 1ave

View 1ave on RCSB PDB site
Description: crystal structure of hen egg-white apo-avidin in relation to its thermal stability properties
Deposited on 1993-03-05, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.166
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1avea_
  • Chain 'B':
    Domains in SCOP 1.61: d1aveb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aveA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    lrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aveB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    lrt