PDB entry 1avd

View 1avd on RCSB PDB site
Description: three-dimensional structure of the tetragonal crystal form of egg- white avidin in its functional complex with biotin at 2.7 angstroms resolution
Deposited on 1993-03-05, released 1994-01-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.174
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1avda_
  • Chain 'B':
    Domains in SCOP 1.67: d1avdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avdA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avdA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    lrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1avdB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avdB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlrt