PDB entry 1avc

View 1avc on RCSB PDB site
Description: bovine annexin vi (calcium-bound)
Class: calcium/phospholipid-binding protein
Keywords: annexin, calcium-binding, membrane-binding, calcium/phospholipid-binding protein
Deposited on 1997-09-16, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.205
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin vi
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P79134 (55-End)
      • conflict (140)
      • conflict (180)
    Domains in SCOPe 2.07: d1avca1, d1avca2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avcA (A:)
    makiaqgakyrgsirdfpdfnpsqdaetlynamkgfgsdkeaiinlitsrsnkqrqeicq
    nykslygkdliadlkyeltgkferlivglmrppayadakeikdaisgigtdekclieila
    srtneqihqlvaaykdayerdleaditgdtsghfrkmlvvllqgtreeddvvsedlvqqd
    vqdlyeagelkwgtdeaqfiyilgnrskqhlrlvfdeylkttgkpieasirgelsgdfek
    lmlavvkcirstaeyfaerlfkamkglgtrdntlirimvsrseldmldireifrtkyeks
    lysmikndtsgeykktllklcggdddaagqffpeaaqvayqmwelsavarvelkgtvrpa
    gdfnpdadakalrkamkglgtdedtiidiithrsnaqrqqirqtfkshfgrdlmadlkse
    lsgdlarlilglmmppahydakqlkkamegagtdekalieilatrtnaeiqainkayked
    yhktledalssdtsghfkrilislatgnreeggedreraredaqvaaeileiadttsgdk
    ssletrfmmilctrsypdlrrvfqefvkmtnydvehtikkemsgdvrdvfvaivqsvknk
    plffadklyksmkgagteektltrimvsrseidllnirrefiekydkslhqaiegdtsgh
    flkallaicgged
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avcA (A:)
    yrgsirdfpdfnpsqdaetlynamkgfgsdkeaiinlitsrsnkqrqeicqnykslygkd
    liadlkyeltgkferlivglmrppayadakeikdaisgigtdekclieilasrtneqihq
    lvaaykdayerdleaditgdtsghfrkmlvvllqgtreeddvvsedlvqqdvqdlyeage
    lkwgtdeaqfiyilgnrskqhlrlvfdeylkttgkpieasirgelsgdfeklmlavvkci
    rstaeyfaerlfkamkglgtrdntlirimvsrseldmldireifrtkyekslysmikndt
    sgeykktllklcggqffpeaaqvayqmwelsavarvelkgtvrpagdfnpdadakalrka
    mkglgtdedtiidiithrsnaqrqqirqtfkshfgrdlmadlkselsgdlarlilglmmp
    pahydakqlkkamegagtdekalieilatrtnaeiqainkaykedyhktledalssdtsg
    hfkrilislatgnreeggedreraredaqvaaeiltrfmmilctrsypdlrrvfqefvkm
    tnydvehtikkemsgdvrdvfvaivqsvknkplffadklyksmkgagteektltrimvsr
    seidllnirrefiekydkslhqaiegdtsghflkallaicgg