PDB entry 1avb

View 1avb on RCSB PDB site
Description: arcelin-1 from phaseolus vulgaris l
Class: lectin
Keywords: lectin-like glycoprotein, plant defense, insecticidal activity, lectin
Deposited on 1997-09-15, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arcelin-1
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avba_
  • Chain 'B':
    Compound: arcelin-1
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avbb_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avbA (A:)
    sndasfnvetfnktnlilqgdatvsseghllltnvkgneedsmgrafysapiqindrtid
    nlasfstnftfrinakniensayglafalvpvgsrpklkgrylglfnttnydrdahtvav
    vfdtvsnrieidvnsirpiatescnfghnngekaevritydspkndlrvsllypsseekc
    hvsatvplekevedwvsvgfsatsgskkettethnvlswsfssnfi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avbB (B:)
    sndasfnvetfnktnlilqgdatvsseghllltnvkgneedsmgrafysapiqindrtid
    nlasfstnftfrinakniensayglafalvpvgsrpklkgrylglfnttnydrdahtvav
    vfdtvsnrieidvnsirpiatescnfghnngekaevritydspkndlrvsllypsseekc
    hvsatvplekevedwvsvgfsatsgskkettethnvlswsfssnfi