PDB entry 1ava

View 1ava on RCSB PDB site
Description: amy2/basi protein-protein complex from barley seed
Class: hydrolase inhibition
Keywords: hydrolase inhibition, enzyme inhibitor complex
Deposited on 1997-09-15, released 1999-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barley alpha-amylase 2(cv menuet)
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1avaa1, d1avaa2
  • Chain 'B':
    Compound: barley alpha-amylase 2(cv menuet)
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1avab1, d1avab2
  • Chain 'C':
    Compound: barley alpha-amylase/subtilisin inhibitor
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1avac_
  • Chain 'D':
    Compound: barley alpha-amylase/subtilisin inhibitor
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1avad_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avaA (A:)
    qvlfqgfnweswkhnggwynflmgkvddiaaagithvwlppasqsvaeqgympgrlydld
    askygnkaqlksligalhgkgvkaiadivinhrtaehkdgrgiycifeggtpdarldwgp
    hmicrddrpyadgtgnpdtgadfgaapdidhlnlrvqkelvewlnwlkadigfdgwrfdf
    akgysadvakiyidrsepsfavaeiwtslayggdgkpnlnqdqhrqelvnwvdkvggkgp
    attfdfttkgilnvavegelwrlrgtdgkapgmigwwpakavtfvdnhdtgstqhmwpfp
    sdrvmqgyayilthpgtpcifydhffdwglkeeidrlvsvrtrhgihnesklqiieadad
    lylaeidgkvivklgprydvgnlipggfkvaahgndyavweki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avaB (B:)
    qvlfqgfnweswkhnggwynflmgkvddiaaagithvwlppasqsvaeqgympgrlydld
    askygnkaqlksligalhgkgvkaiadivinhrtaehkdgrgiycifeggtpdarldwgp
    hmicrddrpyadgtgnpdtgadfgaapdidhlnlrvqkelvewlnwlkadigfdgwrfdf
    akgysadvakiyidrsepsfavaeiwtslayggdgkpnlnqdqhrqelvnwvdkvggkgp
    attfdfttkgilnvavegelwrlrgtdgkapgmigwwpakavtfvdnhdtgstqhmwpfp
    sdrvmqgyayilthpgtpcifydhffdwglkeeidrlvsvrtrhgihnesklqiieadad
    lylaeidgkvivklgprydvgnlipggfkvaahgndyavweki
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avaC (C:)
    adpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfpv
    ritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsps
    grenafriekysgaevheyklmscgdwcqdlgvfrdlkggawflgatepyhvvvfkkapp
    a
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avaD (D:)
    adpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfpv
    ritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsps
    grenafriekysgaevheyklmscgdwcqdlgvfrdlkggawflgatepyhvvvfkkapp
    a