PDB entry 1av6

View 1av6 on RCSB PDB site
Description: vaccinia methyltransferase vp39 complexed with m7g capped RNA hexamer and s-adenosylhomocysteine
Class: transferase/RNA
Keywords: SINGLE-STRANDED RNA, METHYLTRANSFERASE, RNA CAP, POLY(A) POLYMERASE, VACCINIA, MRNA PROCESSING, TRANSCRIPTION, COMPLEX (TRANSFERASE-RNA), TRANSFERASE-RNA complex
Deposited on 1997-09-26, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
    Species: Vaccinia virus WR [TaxId:10254]
    Gene: PAPS, VACWR095, F9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1av6a_
  • Chain 'B':
    Compound: RNA (5'-r(*gp*ap*ap*ap*ap*a)-3')
  • Heterogens: MGT, SAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1av6A (A:)
    vvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgildga
    tvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylr
    sikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpfpd
    qwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnki
    vrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1av6A (A:)
    vvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgildga
    tvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylr
    sikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdf
    yiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnkvv
    vnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip
    

  • Chain 'B':
    No sequence available.