PDB entry 1av1

View 1av1 on RCSB PDB site
Description: crystal structure of human apolipoprotein a-i
Deposited on 1997-09-23, released 1998-02-04
The last revision was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.382
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1av1A (A:)
    mlklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyld
    dfqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrth
    lapysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvl
    esfkvsflsaleeytkklntq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1av1B (B:)
    mlklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyld
    dfqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrth
    lapysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvl
    esfkvsflsaleeytkklntq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1av1C (C:)
    mlklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyld
    dfqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrth
    lapysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvl
    esfkvsflsaleeytkklntq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1av1D (D:)
    mlklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyld
    dfqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrth
    lapysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvl
    esfkvsflsaleeytkklntq