PDB entry 1auz

View 1auz on RCSB PDB site
Description: solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis, nmr, 24 structures
Class: transcription regulator
Keywords: transcription regulator, kinase substrate, anti-anti sigma factor, novel alpha/beta fold
Deposited on 1997-09-08, released 1998-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spoiiaa
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPOIIAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1auza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auzA (A:)
    slgidmnvkesvlcirltgeldhhtaetlkqkvtqslekddirhivlnledlsfmdssgl
    gvilgrykqikqiggemvvcaispavkrlfdmsglfkiirfeqseqqalltlgvas