PDB entry 1auy

View 1auy on RCSB PDB site
Description: turnip yellow mosaic virus
Class: Virus
Keywords: PLANT VIRUS, CAPSID PROTEIN, COAT PROTEIN, JELLYROLL, Icosahedral virus
Deposited on 1997-09-07, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.187
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: turnip yellow mosaic virus
    Species: Turnip yellow mosaic virus [TaxId:12154]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03608 (Start-188)
      • variant (98)
      • variant (122)
      • variant (137)
    Domains in SCOPe 2.07: d1auya_
  • Chain 'B':
    Compound: turnip yellow mosaic virus
    Species: Turnip yellow mosaic virus [TaxId:12154]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03608 (0-188)
      • variant (98)
      • variant (122)
      • variant (137)
    Domains in SCOPe 2.07: d1auyb_
  • Chain 'C':
    Compound: turnip yellow mosaic virus
    Species: Turnip yellow mosaic virus [TaxId:12154]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03608 (0-188)
      • variant (98)
      • variant (122)
      • variant (137)
    Domains in SCOPe 2.07: d1auyc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1auyA (A:)
    meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
    tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
    aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
    splitdtst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auyA (A:)
    spltikqpfqsevlfagtkdaeasltianidsvstlttfyrhasleslwvtihptlqapt
    fpttvgvcwvpaqspvtpaqitktyggqifciggaiqtlsplivkcplemmqprvkdsiq
    yldspkllisitaqptappastciitvsgtlsmhsplitdtst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auyB (B:)
    meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
    tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
    aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
    splitdtst
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auyC (C:)
    meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
    tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
    aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
    splitdtst