PDB entry 1aux

View 1aux on RCSB PDB site
Description: structure of the c domain of synapsin ia from bovine brain with calcium atp-gamma-s bound
Deposited on 1997-09-06, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1auxA (A:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvfaq
    mvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyattepfidakydvriqkigqnykaymrtsvsgnwktntgsamleqiamsd
    ryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvv
    nkmaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auxA (A:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvfaq
    mvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyattepfidakydvriqkigqnykaymrtleqiamsdryklwvdtcseifg
    gldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1auxB (B:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvfaq
    mvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyattepfidakydvriqkigqnykaymrtsvsgnwktntgsamleqiamsd
    ryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvv
    nkmaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auxB (B:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvfaq
    mvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyattepfidakydvriqkigqnykaymrtleqiamsdryklwvdtcseifg
    gldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmaqa