PDB entry 1aux

View 1aux on RCSB PDB site
Description: structure of the c domain of synapsin ia from bovine brain with calcium ATP-gamma-s bound
Class: transferase
Keywords: synapse, phosphorylation, synapsin ia c-domain, ATP-binding, transferase
Deposited on 1997-09-06, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synapsin ia
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auxa1, d1auxa2
  • Chain 'B':
    Compound: synapsin ia
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auxb1, d1auxb2
  • Heterogens: CA, AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1auxA (A:)
    gaaarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlr
    ngvkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvf
    aqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfq
    diasvvaltktyattepfidakydvriqkigqnykaymrtsvsgnwktntgsamleqiam
    sdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivel
    vvnkmaqalpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auxA (A:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvfaq
    mvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyattepfidakydvriqkigqnykaymrtleqiamsdryklwvdtcseifg
    gldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1auxB (B:)
    gaaarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlr
    ngvkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvf
    aqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfq
    diasvvaltktyattepfidakydvriqkigqnykaymrtsvsgnwktntgsamleqiam
    sdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivel
    vvnkmaqalpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auxB (B:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvfaq
    mvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyattepfidakydvriqkigqnykaymrtleqiamsdryklwvdtcseifg
    gldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmaqa