PDB entry 1auw

View 1auw on RCSB PDB site
Description: h91n delta 2 crystallin from duck
Class: eye lens protein
Keywords: eye lens protein, delta 2 crystallin, arginosuccinate lyase
Deposited on 1997-09-03, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.161
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058
      • engineered (90)
      • conflict (274)
      • conflict (442)
    Domains in SCOPe 2.07: d1auwa_
  • Chain 'B':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058
      • engineered (90)
      • conflict (274)
      • conflict (442)
    Domains in SCOPe 2.07: d1auwb_
  • Chain 'C':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058
      • engineered (90)
      • conflict (274)
      • conflict (442)
    Domains in SCOPe 2.07: d1auwc_
  • Chain 'D':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058
      • engineered (90)
      • conflict (274)
      • conflict (442)
    Domains in SCOPe 2.07: d1auwd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1auwA (A:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltdsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auwA (A:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltdsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1auwB (B:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltdsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auwB (B:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltdsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1auwC (C:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltdsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auwC (C:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltdsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1auwD (D:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltdsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auwD (D:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltdsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqk