PDB entry 1auv

View 1auv on RCSB PDB site
Description: structure of the c domain of synapsin ia from bovine brain
Class: transferase
Keywords: synapse, phosphorylation, synapsin ia c-domain, transferase
Deposited on 1997-09-02, released 1998-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synapsin ia
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17599
      • modified residue (55)
      • modified residue (82)
      • modified residue (122)
      • modified residue (148)
      • modified residue (160)
      • modified residue (167)
      • modified residue (217)
      • modified residue (239)
      • modified residue (282)
      • modified residue (304)
    Domains in SCOPe 2.08: d1auva1, d1auva2
  • Chain 'B':
    Compound: synapsin ia
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17599 (0-End)
      • modified residue (55)
      • modified residue (82)
      • modified residue (122)
      • modified residue (148)
      • modified residue (160)
      • modified residue (167)
      • modified residue (217)
      • modified residue (239)
      • modified residue (282)
      • modified residue (304)
    Domains in SCOPe 2.08: d1auvb1, d1auvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1auvA (A:)
    gaaarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlr
    ngvkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvf
    aqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfq
    diasvvaltktyattepfidakydvriqkigqnykaymrtsvsgnwktntgsamleqiam
    sdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivel
    vvnkmaqalpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auvA (A:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvfaq
    mvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyattepfidakydvriqkigqnykaymrtleqiamsdryklwvdtcseifg
    gldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1auvB (B:)
    gaaarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlr
    ngvkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvf
    aqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfq
    diasvvaltktyattepfidakydvriqkigqnykaymrtsvsgnwktntgsamleqiam
    sdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivel
    vvnkmaqalpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auvB (B:)
    gaaarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlr
    ngvkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsinslhsvynfcdkpwvf
    aqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfq
    diasvvaltktyattepfidakydvriqkigqnykaymrleqiamsdryklwvdtcseif
    ggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmaqa