PDB entry 1aur

View 1aur on RCSB PDB site
Description: pmsf-inhibited carboxylesterase from pseudomonas fluorescens
Class: hydrolase
Keywords: hydrolase
Deposited on 1997-09-01, released 1998-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aura_
  • Chain 'B':
    Compound: carboxylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aurb_
  • Heterogens: PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aurA (A:)
    mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
    gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
    fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
    ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aurB (B:)
    mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
    gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
    fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
    ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg