PDB entry 1aup

View 1aup on RCSB PDB site
Description: glutamate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, nad
Deposited on 1997-09-01, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-specific glutamate dehydrogenase
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: GDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24295 (0-448)
      • engineered (88)
      • engineered (379)
    Domains in SCOPe 2.07: d1aupa1, d1aupa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aupA (A:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpylgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgn
    vawgaakklaelgakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfg
    vqffpgekpwgqkvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmq
    qpnmvvapskavnaggvlvvgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaery
    glgynlvaganivgfqkiadammaqgiaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aupA (A:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpylgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvlrpeatgygsvyyveavmkhendtlvgktvalagfgnvawgaakklael
    gakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfgvqffpgekpwgq
    kvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmqqpnmvvapskav
    naggvlvvgfetaeevdsklhqvmtdihdgsaaaaeryglgynlvaganivgfqkiadam
    maqgiaw