PDB entry 1aun

View 1aun on RCSB PDB site
Description: pathogenesis-related protein 5d from nicotiana tabacum
Deposited on 1997-08-29, released 1998-03-04
The last revision prior to the SCOP 1.71 freeze date was dated 1998-03-04, with a file datestamp of 1998-03-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1aun__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aun_ (-)
    sgvfevhnncpytvwaaatpvgggrrlergqswwfwappgtkmariwgrtncnfdgagrg
    wcqtgdcggvleckgwgkppntlaeyalnqfsnldfwdisvidgfnipmsfgptkpgpgk
    chgiqctaningecpgslrvpggcnnpcttfggqqycctqgpcgptelsrwfkqrcpday
    sypqddptstftctswttdykvmfcpyg