PDB entry 1aun

View 1aun on RCSB PDB site
Description: pathogenesis-related protein 5d from nicotiana tabacum
Class: antifungal protein
Keywords: antifungal protein, pathogenesis-related protein, pr-5d, osmotin, thaumatin-like protein
Deposited on 1997-08-29, released 1998-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pr-5d
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1auna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aunA (A:)
    sgvfevhnncpytvwaaatpvgggrrlergqswwfwappgtkmariwgrtncnfdgagrg
    wcqtgdcggvleckgwgkppntlaeyalnqfsnldfwdisvidgfnipmsfgptkpgpgk
    chgiqctaningecpgslrvpggcnnpcttfggqqycctqgpcgptelsrwfkqrcpday
    sypqddptstftctswttdykvmfcpyg