PDB entry 1aun

View 1aun on RCSB PDB site
Description: pathogenesis-related protein 5d from nicotiana tabacum
Class: antifungal protein
Keywords: antifungal protein, pathogenesis-related protein, pr-5d, osmotin, thaumatin-like protein
Deposited on 1997-08-29, released 1998-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pr-5d
  Species: Nicotiana tabacum [TaxId:4097]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25871 (0-207)
  Domains in SCOPe 2.07: d1auna_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aunA (A:)
  sgvfevhnncpytvwaaatpvgggrrlergqswwfwappgtkmariwgrtncnfdgagrg
  wcqtgdcggvleckgwgkppntlaeyalnqfsnldfwdisvidgfnipmsfgptkpgpgk
  chgiqctaningecpgslrvpggcnnpcttfggqqycctqgpcgptelsrwfkqrcpday
  sypqddptstftctswttdykvmfcpyg