PDB entry 1aum

View 1aum on RCSB PDB site
Description: hiv capsid c-terminal domain (cac146)
Class: Viral protein
Keywords: CORE PROTEIN, HIV, CAPSID, C-TERMINAL DOMAIN, CAC146, Viral protein
Deposited on 1997-08-29, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.355
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aumA (A:)
    ldirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpgat
    leemmtacqg