PDB entry 1aug

View 1aug on RCSB PDB site
Description: crystal structure of the pyroglutamyl peptidase I from bacillus amyloliquefaciens
Class: thiol protease
Keywords: pyroglutamyl peptidase, cysteine proteinase, bacillus amyloliquefaciens, hydrolase, thiol protease
Deposited on 1997-08-26, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyroglutamyl peptidase-1
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auga_
  • Chain 'B':
    Compound: pyroglutamyl peptidase-1
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1augb_
  • Chain 'C':
    Compound: pyroglutamyl peptidase-1
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1augc_
  • Chain 'D':
    Compound: pyroglutamyl peptidase-1
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1augd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1augA (A:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietgggelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1augA (A:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1augB (B:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietgggelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1augB (B:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1augC (C:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietgggelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1augC (C:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1augD (D:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietgggelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1augD (D:)
    mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
    hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
    riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
    apslsldhitkalkiaavtaavheddietg