PDB entry 1auc

View 1auc on RCSB PDB site
Description: human thioredoxin (oxidized with diamide)
Deposited on 1997-08-22, released 1998-02-25
The last revision prior to the SCOP 1.61 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY+
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1auc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auc_ (-)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv