PDB entry 1auc

View 1auc on RCSB PDB site
Description: human thioredoxin (oxidized with diamide)
Class: oxidoreductase
Keywords: oxidoreductase, dimer, thioredoxin, x-ray crystallography, electron transport
Deposited on 1997-08-22, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10599 (1-104)
  Domains in SCOPe 2.07: d1auca_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aucA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
  dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv