PDB entry 1aub

View 1aub on RCSB PDB site
Description: n-terminal domain of hiv-2 integrase, nmr, 20 structures
Class: integrase
Keywords: integrase, aids, polyprotein
Deposited on 1997-08-22, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 1998-10-14, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-2 integrase
    Species: Human immunodeficiency virus type 2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1auba_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aubA (A:)
    flekiepaqeehekyhsnvkelshkfgipnlvarqivnscaqcqqk