PDB entry 1aua

View 1aua on RCSB PDB site
Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae
Class: phospholipid-binding protein
Keywords: phospholipid-binding protein, peripheral golgi membrane protein, phospholipid exchange, golgi-derived secretory vesicle biogenesis
Deposited on 1997-08-20, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol transfer protein sec14p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auaa1, d1auaa2
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1auaA (A:)
qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
arkfdvqlakemfencekwrkdygtdtilqdfhydekpliakfypqyyhktdkdgrpvyf
eelgavnlhemnkvtseermlknlvweyesvvqyrlpacsraaghlvetsctimdlkgis
issaysvmsyvreasyisqnyypermgkfyiinapfgfstafrlfkpfldpvtvskifil
gssyqkellkqipaenlpvkfggksevdeskgglylsdigpwrdpkyigpegeape