PDB entry 1aua

View 1aua on RCSB PDB site
Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae
Deposited on 1997-08-20, released 1997-12-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aua_ (-)
    qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
    arkfdvqlakemfencekwrkdygtdtilqdfhydekpliakfypqyyhktdkdgrpvyf
    eelgavnlhemnkvtseermlknlvweyesvvqyrlpacsraaghlvetsctimdlkgis
    issaysvmsyvreasyisqnyypermgkfyiinapfgfstafrlfkpfldpvtvskifil
    gssyqkellkqipaenlpvkfggksevdeskgglylsdigpwrdpkyigpegeape