PDB entry 1au7

View 1au7 on RCSB PDB site
Description: pit-1 mutant/DNA complex
Class: transcription/DNA
Keywords: complex (DNA-binding protein/DNA), pituitary, cphd, pou domain, transcription factor, transcription/DNA complex
Deposited on 1997-09-12, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein pit-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PIT-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10037 (0-145)
      • engineered (0-1)
      • conflict (3)
      • conflict (95)
    Domains in SCOPe 2.07: d1au7a1, d1au7a2
  • Chain 'B':
    Compound: protein pit-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PIT-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10037 (0-145)
      • engineered (0-1)
      • conflict (3)
      • conflict (95)
    Domains in SCOPe 2.07: d1au7b1, d1au7b2
  • Chain 'C':
    Compound: consensus DNA 25-mer
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*tp*cp*cp*tp*cp*ap*tp*gp*tp*ap*tp*ap*tp*ap*c p*ap*tp*gp*ap*gp* gp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1au7A (A:)
    gmraleqfanefkvrriklgytqtnvgealaavhgsefsqtticrfenlqlsfknacklk
    ailskwleeaeqvgalynekvganerkrkrrttisiaakdalerhfgehskpssqeimrm
    aeelnlekevvrvwfcnrrqrekrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1au7A (A:)
    gmraleqfanefkvrriklgytqtnvgealaavhgsefsqtticrfenlqlsfknacklk
    ailskwleeaeqkrrttisiaakdalerhfgehskpssqeimrmaeelnlekevvrvwfc
    nrrqrekrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1au7B (B:)
    gmraleqfanefkvrriklgytqtnvgealaavhgsefsqtticrfenlqlsfknacklk
    ailskwleeaeqvgalynekvganerkrkrrttisiaakdalerhfgehskpssqeimrm
    aeelnlekevvrvwfcnrrqrekrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1au7B (B:)
    gmraleqfanefkvrriklgytqtnvgealaavhgsefsqtticrfenlqlsfknacklk
    ailskwleeakrrttisiaakdalerhfgehskpssqeimrmaeelnlekevvrvwfcnr
    rqrekrvk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.