PDB entry 1au3

View 1au3 on RCSB PDB site
Description: crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor
Deposited on 1997-09-10, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1au3__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1au3_ (-)
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm