PDB entry 1au0

View 1au0 on RCSB PDB site
Description: crystal structure of the cysteine protease human cathepsin k in complex with a covalent symmetric diacylaminomethyl ketone inhibitor
Class: hydrolase
Keywords: hydrolase, sulfhydryl proteinase
Deposited on 1997-09-09, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1au0a_
  • Heterogens: SDK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1au0A (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm