PDB entry 1au0

View 1au0 on RCSB PDB site
Description: crystal structure of the cysteine protease human cathepsin k in complex with a covalent symmetric diacylaminomethyl ketone inhibitor
Class: hydrolase
Keywords: hydrolase, sulfhydryl proteinase
Deposited on 1997-09-09, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cathepsin k
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43235 (0-214)
  Domains in SCOPe 2.08: d1au0a_
• Heterogens: SDK, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1au0A (A:)
  apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
  dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
  lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
  knswgenwgnkgyilmarnknnacgianlasfpkm