PDB entry 1atz

View 1atz on RCSB PDB site
Description: human von willebrand factor a3 domain
Deposited on 1997-08-15, released 1998-02-25
The last revision prior to the SCOP 1.67 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1atza_
  • Chain 'B':
    Domains in SCOP 1.67: d1atzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1atzA (A:)
    dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
    wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
    vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
    nsflhklcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atzA (A:)
    qpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpwnv
    vpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsvds
    vdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgnsf
    lhkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atzB (B:)
    dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
    wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
    vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
    nsflhklcs