PDB entry 1aty

View 1aty on RCSB PDB site
Description: determination of local protein structure by spin label difference 2d nmr: the region neighboring asp61 of subunit c of the f1fo ATP synthase
Class: membrane protein
Keywords: membrane protein
Deposited on 1994-10-05, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: f1f0 ATP synthase (subunit c)
  Species: Escherichia coli [TaxId:562]
  Gene: UNCE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68699 (Start-78)
    • conflict (66)
  Domains in SCOPe 2.08: d1atya_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1atyA (A:)
  menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
  daipmicvglglyvmfava
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1atyA (A:)
  lymaaavmmglaaigaaiqffivmglvdaipmicvglglyvmfava