PDB entry 1atx

View 1atx on RCSB PDB site
Description: three-dimensional structure of the neurotoxin atx ia from anemonia sulcata in aqueous solution determined by nuclear magnetic resonance spectroscopy
Class: sea anemone toxin
Keywords: sea anemone toxin
Deposited on 1990-05-14, released 1991-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: atx ia
  Species: Anemonia sulcata [TaxId:6108]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01533 (0-45)
  Domains in SCOPe 2.08: d1atxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1atxA (A:)
  gaaclcksdgpntrgnsmsgtiwvfgcpsgwnncegraiigycckq