PDB entry 1atu

View 1atu on RCSB PDB site
Description: uncleaved alpha-1-antitrypsin
Class: serine protease inhibitor
Keywords: serine protease inhibitor, alpha-1-antitrypsin, conformational transition, loop flexibility, metastability, stabilizing mutations
Deposited on 1997-05-11, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01009 (0-373)
      • engineered (30)
      • engineered (38)
      • engineered (47)
      • engineered (49)
      • engineered (353)
      • engineered (360)
      • engineered (366)
    Domains in SCOPe 2.07: d1atua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atuA (A:)
    ptfnkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeilegl
    nfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhs
    eaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfev
    kdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegkl
    qhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsg
    vteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvfliieqntk
    aplfmgrvvnptqk