PDB entry 1atr

View 1atr on RCSB PDB site
Description: threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for ATP hydrolysis
Class: chaperone protein
Keywords: chaperone protein
Deposited on 1993-08-09, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat-shock cognate 70 kd protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19120
      • conflict (203)
    Domains in SCOPe 2.07: d1atra1, d1atra2
  • Heterogens: MG, PO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1atrA (A:)
    mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
    smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
    iaygldkkvgaernvlifdlgggvfdvsiltiedgifevkstagdthlggedfdnrmvnh
    fiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitra
    rfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkeln
    ksinpdeavaygaavqaailsgdkse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atrA (A:)
    skgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvam
    nptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevss
    mvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaai
    aygldkkvgaernvlifdlgggvfdvsiltiedgifevkstagdthlggedfdnrmvnhf
    iaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrar
    feelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnk
    sinpdeavaygaavqaailsgdk