PDB entry 1atl

View 1atl on RCSB PDB site
Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)
Deposited on 1995-05-26, released 1995-10-15
The last revision prior to the SCOP 1.67 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1atla_
  • Chain 'B':
    Domains in SCOP 1.67: d1atlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1atlA (A:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atlA (A:)
    lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
    dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
    igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
    mhyyerflkqykpqcilnkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1atlB (B:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atlB (B:)
    lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
    dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
    igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
    mhyyerflkqykpqcilnkp