PDB entry 1atl

View 1atl on RCSB PDB site
Description: Structural interaction of natural and synthetic inhibitors with the VENOM METALLOPROTEINASE, ATROLYSIN C (FORM-D)
Class: hydrolase/hydrolase inhibitor
Keywords: METALLOENDOPEPTIDASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1995-05-26, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: atrolysin c
    Species: Crotalus atrox [TaxId:8730]
    Domains in SCOPe 2.07: d1atla_
  • Chain 'B':
    Compound: atrolysin c
    Species: Crotalus atrox [TaxId:8730]
    Domains in SCOPe 2.07: d1atlb_
  • Heterogens: ZN, CA, 0QI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1atlA (A:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atlA (A:)
    lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
    dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
    igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
    mhyyerflkqykpqcilnkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1atlB (B:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atlB (B:)
    lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
    dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
    igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
    mhyyerflkqykpqcilnkp