PDB entry 1atj

View 1atj on RCSB PDB site
Description: recombinant horseradish peroxidase c1a
Deposited on 1997-08-14, released 1998-02-04
The last revision prior to the SCOP 1.59 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1atja_
  • Chain 'B':
    Domains in SCOP 1.59: d1atjb_
  • Chain 'C':
    Domains in SCOP 1.59: d1atjc_
  • Chain 'D':
    Domains in SCOP 1.59: d1atjd_
  • Chain 'E':
    Domains in SCOP 1.59: d1atje_
  • Chain 'F':
    Domains in SCOP 1.59: d1atjf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atjA (A:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvns
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atjB (B:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvns
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atjC (C:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvns
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atjD (D:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvns
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atjE (E:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvns
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atjF (F:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvns