PDB entry 1atg

View 1atg on RCSB PDB site
Description: azotobacter vinelandii periplasmic molybdate-binding protein
Deposited on 1997-08-14, released 1998-10-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.1644
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1atg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1atg_ (-)
elkvvtatnflgtleqlagqfakqtghavvissgssgpvyaqivngapynvffsadeksp
ekldnqgfalpgsrftyaigklvlwsakpglvdnqgkvlagngwrhiaisnpqiapygla
gtqvlthlglldkltaqeriveansvgqahsqtasgaadlgfvalaqiiqaaakipgshw
fppanyyepivqqavitkstaekanaeqfmswmkgpkavaiikaagyvlpq