PDB entry 1atg

View 1atg on RCSB PDB site
Description: azotobacter vinelandii periplasmic molybdate-binding protein
Class: binding protein
Keywords: molybdate, tungstate, binding protein, periplasm, abc transporter
Deposited on 1997-08-14, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.164
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic molybdate-binding protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1atga_
  • Heterogens: WO4, ACT, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atgA (A:)
    elkvvtatnflgtleqlagqfakqtghavvissgssgpvyaqivngapynvffsadeksp
    ekldnqgfalpgsrftyaigklvlwsakpglvdnqgkvlagngwrhiaisnpqiapygla
    gtqvlthlglldkltaqeriveansvgqahsqtasgaadlgfvalaqiiqaaakipgshw
    fppanyyepivqqavitkstaekanaeqfmswmkgpkavaiikaagyvlpq